Iright
BRAND / VENDOR: Proteintech

Proteintech, 12562-1-AP, AK3 Polyclonal antibody

CATALOG NUMBER: 12562-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AK3 (12562-1-AP) by Proteintech is a Polyclonal antibody targeting AK3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12562-1-AP targets AK3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Y79 cells, L02 cells, mouse heart tissue, mouse kidney tissue, rat heart tissue, rat kidney Positive IP detected in: mouse kidney tissue Positive IHC detected in: human pancreas cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AK3(Adenylate kinase 3) is also named as AK3L1, AK6, AKL3L and belongs to the adenylate kinase family. It is located in the mitochondrial matrix and is a GTP:AMP phosphotransferase(PMID:2546792). AK3 can be detected AK3 at an apparent molecular mass of 28 kD by western blot analysis and subcellular fractionation of mouse liver and kidney detected Ak3 in the mitochondrial fraction(PMID:11485571). This antibody may also recognize AK4 due to the high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3146 Product name: Recombinant human AK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC013771 Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP Predict reactive species Full Name: adenylate kinase 3 Calculated Molecular Weight: 227 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC013771 Gene Symbol: AK3 Gene ID (NCBI): 50808 RRID: AB_2305373 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UIJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924