Proteintech, 12595-1-AP, PANX1 Polyclonal antibody

Size: 20ul / 150ul The PANX1 (12595-1-AP) by Proteintech is a Polyclonal antibody targeting PANX1 in WB, ELISA applications with reactivity to human, mouse samples 12595-1-AP targets PANX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, SH-SY5Y cells, K-562 cells, MDA-MB-231 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PANX1, also named as MRS1, belongs to the pannexin family. It plays a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis. It is a structural component of the gap junctions and the hemichannels. PANX1 induced the formation of intercellular channels with characteristics of gap junctions. PANX1 is 48-kDa protein which contains 4 transmembrane domains and cytoplasmic N and C termini. It is a mediator of find-me signal/nucleotide release from apoptotic cells. Western blot for Panx1 was also seen in two bands at 45~50 kDa and ~90 kDa. The band of ~90 kDa corresponding to the Panx1 dimer size. (PMID: 24590064, PMID: 19009624) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3174 Product name: Recombinant human PANX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-426 aa of BC016931 Sequence: FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC Predict reactive species Full Name: pannexin 1 Calculated Molecular Weight: 426 aa, 48 kDa Observed Molecular Weight: 45-50 kDa, 90 kDa GenBank Accession Number: BC016931 Gene Symbol: PANX1 Gene ID (NCBI): 24145 RRID: AB_2159186 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.