Proteintech, 12598-1-AP, OSCP1 Polyclonal antibody

Size: 20ul / 150ul The OSCP1 (12598-1-AP) by Proteintech is a Polyclonal antibody targeting OSCP1 in WB, ELISA applications with reactivity to mouse samples 12598-1-AP targets OSCP1 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse brain tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3209 Product name: Recombinant human C1orf102 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-379 aa of BC018069 Sequence: MSVRTLPLLFLNLGGEMLYILDQRLRAQNIRGDKARKVLNDIISTMFNRKFMEELFKPQELYSKKALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETLRQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEEVKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLARLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLSTGKGDDLLAMMDEL Predict reactive species Full Name: chromosome 1 open reading frame 102 Calculated Molecular Weight: 379 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC018069 Gene Symbol: OSCP1 Gene ID (NCBI): 127700 RRID: AB_11232418 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.