Iright
BRAND / VENDOR: Proteintech

Proteintech, 12599-1-AP, CTBS Polyclonal antibody

CATALOG NUMBER: 12599-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CTBS (12599-1-AP) by Proteintech is a Polyclonal antibody targeting CTBS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12599-1-AP targets CTBS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells Positive IHC detected in: human prostate cancer tissue, human liver cancer tissue, human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information CTBS(Di-N-acetylchitobiase (chitobiase)) also named as CTB, is a lysosomal exoglycosidase that splits the GlcNAcβ-D-(l-4)GlcNAc chitobiose core of asparagine-linked glycoproteins. Chitobiase has been purified from human liver and kidney and rat liver. Both the human and rat enzymes are approximately 40-45 kDa and require a free reducing end GlcNAc for activity(PMID:1527079). This full length protein has a signal peptide and four glycosylation sites. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3228 Product name: Recombinant human CTBS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC024007 Sequence: MSRPQLRRWRLVSSPPSGVPGLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL Predict reactive species Full Name: chitobiase, di-N-acetyl- Calculated Molecular Weight: 12 kDa, 43 kDa Observed Molecular Weight: 44-50 kDa GenBank Accession Number: BC024007 Gene Symbol: CTBS Gene ID (NCBI): 1486 RRID: AB_10638783 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01459 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924