Proteintech, 12607-1-AP, TRIM23 Polyclonal antibody

Size: 20ul / 150ul The TRIM23 (12607-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM23 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 12607-1-AP targets TRIM23 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3302 Product name: Recombinant human TRIM23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 275-574 aa of BC022510 Sequence: EHVPGTAENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDDCRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA Predict reactive species Full Name: tripartite motif-containing 23 Calculated Molecular Weight: 574 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC022510 Gene Symbol: TRIM23 Gene ID (NCBI): 373 RRID: AB_2256643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36406 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.