Proteintech, 12608-1-AP, USP12 Polyclonal antibody

Size: 20ul / 150ul The USP12 (12608-1-AP) by Proteintech is a Polyclonal antibody targeting USP12 in WB, ELISA applications with reactivity to human, mouse, rat samples 12608-1-AP targets USP12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Ubiquitin-specific peptidase 12 (USP12) belongs to the ubiquitin-specific protease (USP) family of deubiquitinases that are critical for ubiquitin signaling and protein quality control. USPs function as cysteine proteases to trim or remove ubiquitin conjugates from selected substrates. Deubiquitination is important for ubiquitin signaling-mediated processes, such as regulation of protein levels or activity. Depletion of USP12 suppressed cell growth and clonogenicity and inhibited autophagy(PMID: 30266909 34997217 35898171). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3309 Product name: Recombinant human USP12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-370 aa of BC026072 Sequence: MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVDEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD Predict reactive species Full Name: ubiquitin specific peptidase 12 Calculated Molecular Weight: 370 aa, 43 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC026072 Gene Symbol: USP12 Gene ID (NCBI): 219333 RRID: AB_10641037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75317 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.