Proteintech, 12611-1-AP, ECOP Polyclonal antibody

Size: 20ul / 150ul The ECOP (12611-1-AP) by Proteintech is a Polyclonal antibody targeting ECOP in WB, IHC, ELISA applications with reactivity to human, mouse samples 12611-1-AP targets ECOP in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Transfected HEK-293 cells Positive IHC detected in: human kidney tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ECOP, also named as VOPP1 and GASP, has been previously shown to be over-expressed in human glioblastoma multiforme and squamous cell carcinoma. It interacts directly with cytoplasmic mediators of the NF kappa B pathway. ECOP has three isoforms with MW 18-19 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3225 Product name: Recombinant human ECOP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-172 aa of BC016650 Sequence: KKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMGVLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQVPPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK Predict reactive species Full Name: EGFR-coamplified and overexpressed protein Calculated Molecular Weight: 172 aa, 19 kDa GenBank Accession Number: BC016650 Gene Symbol: ECOP Gene ID (NCBI): 81552 RRID: AB_2877866 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.