Proteintech, 12623-1-AP, ZnT4 Polyclonal antibody

Size: 20ul / 150ul The ZnT4 (12623-1-AP) by Proteintech is a Polyclonal antibody targeting ZnT4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 12623-1-AP targets ZnT4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ZnT4, also known as SLC30A4, belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. ZnT4 transports Zn into the trans-Golgi apparatus for lactose synthesis, and across the apical cell membrane for efflux from MECs into milk. ZnT4 is expressed in numerous tissues and is enriched in the prostate. ZnT4 encodes a protein with a molecular weight of 47 kDa (PMID: 26538236). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3313 Product name: Recombinant human SLC30A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC026089 Sequence: MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL Predict reactive species Full Name: solute carrier family 30 (zinc transporter), member 4 Calculated Molecular Weight: 429 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC026089 Gene Symbol: ZNT4 Gene ID (NCBI): 7782 RRID: AB_3085398 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14863 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.