Proteintech, 12629-1-AP, Calmegin Polyclonal antibody

Size: 20ul / 150ul The Calmegin (12629-1-AP) by Proteintech is a Polyclonal antibody targeting Calmegin in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12629-1-AP targets Calmegin in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, human brain tissue, human lung tissue, mouse brain tissue, mouse lung tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Calmegin, belonging to the calreticulin family, is a testis-specific molecular chaperon of the endoplasmic reticulum playing a key role in spermatogenesis. Western blot analysis of mouse testis showed a single band with an apparent molecular mass of 93 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3322 Product name: Recombinant human CLGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 311-610 aa of BC028357 Sequence: PAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD Predict reactive species Full Name: calmegin Calculated Molecular Weight: 610 aa, 70 kDa Observed Molecular Weight: 93 kDa GenBank Accession Number: BC028357 Gene Symbol: Calmegin Gene ID (NCBI): 1047 RRID: AB_2276364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14967 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.