Proteintech, 12635-1-AP, GNAO1 Polyclonal antibody

Size: 20ul / 150ul The GNAO1 (12635-1-AP) by Proteintech is a Polyclonal antibody targeting GNAO1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 12635-1-AP targets GNAO1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, Y79 cells, human liver tissue, mouse testis tissue, rat testis tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GNAO1 gene encodes the α subunit of heterotrimeric guanine nucleotide-binding protein (Gi protein), a membrane protein widely expressed in the central nervous system involved in signal transduction (PMID: 30642806). GNAO1 belongs to the G-alpha family and G(i/o/t/z) subfamily. GNAO1 is highly expressed in brain and modulate neuronal excitability (PMID: 30838255). GNAO1 has 2 isoforms with the molecular mass of 40 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3330 Product name: Recombinant human GNAO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC030027 Sequence: MKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY Predict reactive species Full Name: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O Calculated Molecular Weight: 302 aa, 35 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC030027 Gene Symbol: GNAO1 Gene ID (NCBI): 2775 RRID: AB_2111635 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P09471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.