Proteintech, 12638-1-AP, CIAPIN1 Polyclonal antibody

Size: 20ul / 150ul The CIAPIN1 (12638-1-AP) by Proteintech is a Polyclonal antibody targeting CIAPIN1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12638-1-AP targets CIAPIN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, Jurkat cells, K-562 cells, mouse brain tissue, mouse liver tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information The cytokine-induced anti-apoptotic molecule (CIAPIN1, or DRE2) had been found to be a differentially-expressed gene involved in a variety of cancers, and it was also considered as a candidate tumor suppressor gene in gastric cancer, renal cancer and liver cancer. CIAPIN1 plays an important role in the differentiation of colorectal cancer (CRC) cells, and the differential expression of CIAPIN1 in CRC was closely related to prognosis. CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a valuable prognostic indicator in esophageal squamous cell carcinoma (ESCC). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3333 Product name: Recombinant human CIAPIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-312 aa of BC024196 Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA Predict reactive species Full Name: cytokine induced apoptosis inhibitor 1 Calculated Molecular Weight: 312 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC024196 Gene Symbol: CIAPIN1 Gene ID (NCBI): 57019 RRID: AB_2079665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6FI81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.