Iright
BRAND / VENDOR: Proteintech

Proteintech, 12652-1-AP, TMEM16A/DOG1 Polyclonal antibody

CATALOG NUMBER: 12652-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM16A/DOG1 (12652-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM16A/DOG1 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 12652-1-AP targets TMEM16A/DOG1 in IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lung cancer tissue, mouse pancreas tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ANO1 also named as DOG1, ORAOV2, TAOS2 and TMEM16A, acts as a calcium-activated chloride channel. It is required for normal tracheal development. ANO1 (or DOG1) is used as an aid in the identification and diagnosis of gastrointestinal stromal tumors (GIST) within the context of an antibody panel, the patient's clinical history, and other diagnostic tests evaluated by a qualified pathologist. The immunogen is the C-terminal of ANO1. This antibody can recognize isoform1 and isoform2 of human ANO1. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3320 Product name: Recombinant human ANO1,DOG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 541-712 aa of BC027590 Sequence: LVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQEIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL Predict reactive species Full Name: anoctamin 1, calcium activated chloride channel Calculated Molecular Weight: 986 aa, 114 kDa Observed Molecular Weight: 114 kDa GenBank Accession Number: BC027590 Gene Symbol: TMEM16A Gene ID (NCBI): 55107 RRID: AB_2722560 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5XXA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924