Iright
BRAND / VENDOR: Proteintech

Proteintech, 12659-1-AP, GPR155 Polyclonal antibody

CATALOG NUMBER: 12659-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPR155 (12659-1-AP) by Proteintech is a Polyclonal antibody targeting GPR155 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 12659-1-AP targets GPR155 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The G Protein-coupled receptor 155 (GPR155), also known as Lysosomal cholesterol signaling protein (LYCHOS), is a cholesterol receptor on the lysosome. GRR155 plays a role in the cholesterol-sensing lysosomal pathway and couples cholesterol concentration to MTORC1-dependent anabolic signaling (PMID: 36007018). GPR155 may represent a biomarker for diagnosing and predicting hematogenous metastasis of gastric cancer (PMID: 28165032). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3328 Product name: Recombinant human GPR155 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 540-870 aa of BC028730 Sequence: MCMNQTAQAGGYEGFDQSQSHKVVEPGNTAFEESPAPVNEPELFTSSIPETSCCSCSMGNGELHCPSIEPIANTSTSEPVIPSFEKNNHCVSRCNSQSCILAQEEEQYLQSGDQQLTRHVLLCLLLIIGLFANLYSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRLEFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEFRDEYLFYRFLQKSPEQSPPAINANTLQQERYKEIEHSSPPSHSPKT Predict reactive species Full Name: G protein-coupled receptor 155 Calculated Molecular Weight: 870 aa, 97 kDa Observed Molecular Weight: 97 kDa, 75 kDa GenBank Accession Number: BC028730 Gene Symbol: GPR155 Gene ID (NCBI): 151556 RRID: AB_2877869 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z3F1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924