Iright
BRAND / VENDOR: Proteintech

Proteintech, 12672-1-AP, SHCBP1 Polyclonal antibody

CATALOG NUMBER: 12672-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SHCBP1 (12672-1-AP) by Proteintech is a Polyclonal antibody targeting SHCBP1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 12672-1-AP targets SHCBP1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Sp2/0 cells, Neuro-2a cells, HepG2 cells, mouse thymus tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human liver cancer tissue, human tonsillitis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SHCBP1 was initially identified as a potential gene associated with cell proliferation in fibroblasts. SHCBP1 exerts a crucial physiological function in normal tissue development. Chen et al. showed that SHCBP1 is an essential component of FGF signaling in neural progenitor cells. SHCBP1 is also upregulated during T cell proliferation and regulates CD4+ T cell effector function in vivo. Recently, SHCBP1 was shown to be closely associated with cancer development. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3355 Product name: Recombinant human SHCBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-672 aa of BC030699 Sequence: NACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF Predict reactive species Full Name: SHC SH2-domain binding protein 1 Calculated Molecular Weight: 672 aa, 76 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC030699 Gene Symbol: SHCBP1 Gene ID (NCBI): 79801 RRID: AB_10639526 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924