Proteintech, 12676-1-AP, BBS3 Polyclonal antibody

Size: 20ul / 150ul The BBS3 (12676-1-AP) by Proteintech is a Polyclonal antibody targeting BBS3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples 12676-1-AP targets BBS3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: rat brain tissue, HEK-293T cells, human brain tissue, mouse brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: hTERT-RPE1 cells, MDCK cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ADP-ribosylation factor-like protein 6 (ARL6), belongs to a small GTPase superfamily, is involved in membrane protein trafficking at the base of the ciliary organelle. ARL6 is also named Bardet-Biedl syndrome 3 protein, because defects in ARL6 are a cause of Bardet-Biedl syndrome type 3 (BBS3), which is a genetically heterogeneous disorder characterized by usually severe pigmentary retinopathy, early onset obesity, polydactyly, hypogenitalism, renal malformation and mental retardation. ARL6 can interact with many ARL6 interacting proteins and form BBSome complex with other BBS proteins including BBS1, BBS2, BBS4 and so on. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3363 Product name: Recombinant human BBS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC024239 Sequence: MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT Predict reactive species Full Name: ADP-ribosylation factor-like 6 Calculated Molecular Weight: 186 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC024239 Gene Symbol: ARL6/BBS3 Gene ID (NCBI): 84100 RRID: AB_2058675 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H0F7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.