Proteintech, 12701-1-AP, OMG Polyclonal antibody

Size: 20ul / 150ul The OMG (12701-1-AP) by Proteintech is a Polyclonal antibody targeting OMG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12701-1-AP targets OMG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spinal cord tissue, mouse brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information OMG (oligodendrocyte myelin glycoprotein), also known as OMGP. It is expected to be located in cell membrane, the protein is mainly expressed in the central nervous system in both neurons and oligodendrocytes. The calculated molecular weight of OMG is 50 kDa, and o-glycosylated in its Ser/Thr-rich repeat domain. It is also a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system. Axonal regeneration in the adult spinal cord is thought to be at least partially blocked after injury by inhibitory myelin components, including Nogo, myelin associated glycoprotein (MAG) and oligodendrocyte-myelin glycoprotein (OMGP). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3210 Product name: Recombinant human OMG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-440 aa of BC018050 Sequence: SLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLKWMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKVTKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDGMVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVANAWKVNASFLLLLNVVVMLAV Predict reactive species Full Name: oligodendrocyte myelin glycoprotein Calculated Molecular Weight: 440 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC018050 Gene Symbol: OMG Gene ID (NCBI): 4974 RRID: AB_2877877 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23515 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.