Iright
BRAND / VENDOR: Proteintech

Proteintech, 12722-1-AP, CATSPER1 Polyclonal antibody

CATALOG NUMBER: 12722-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CATSPER1 (12722-1-AP) by Proteintech is a Polyclonal antibody targeting CATSPER1 in WB, ELISA applications with reactivity to human samples 12722-1-AP targets CATSPER1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Cation channel sperm-associated protein 1 (CATSPER1) belongs to a family of four sperm-specific tetrameric voltage-gated cation channels that are highly conserved in humans and mice (PMID: 12402840; 12932298). Definitive evidence that CatSper1 functions as a voltage-gated calcium channel to facilitate hyperactivated sperm motility came from whole-cell patch-clamp measurements of spermatozoa (PMID: 16467839). CATSPER1 channel currents were potentiated in response to intracellular alkalinization, increasing the concentration of intraflagellar calcium and thereby inducing hyperactivity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3417 Product name: Recombinant human CATSPER1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC032950 Sequence: MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQALSSHVHQSHHHSEARNHVRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYSGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYHQH Predict reactive species Full Name: cation channel, sperm associated 1 Calculated Molecular Weight: 780 aa, 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC032950 Gene Symbol: CATSPER1 Gene ID (NCBI): 117144 RRID: AB_3669148 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924