Iright
BRAND / VENDOR: Proteintech

Proteintech, 12745-1-AP, MEK6 Polyclonal antibody

CATALOG NUMBER: 12745-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MEK6 (12745-1-AP) by Proteintech is a Polyclonal antibody targeting MEK6 in WB, IHC, ELISA applications with reactivity to human, mouse samples 12745-1-AP targets MEK6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, human kidney tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MAPKK6 (Dual specificity mitogen activated protein kinase kinase 6), also known as MAP2K6 / MEK6 / MKK6, is a member of MAPKK protein kinase family. MKK6 plays an important role in intracellular signaling pathways leading toward activation of the p38 MAP kinase. MEK6 phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. MEK6 plays a complex role in cancer, with some evidence showing it can promote tumor growth. Overexpression of MEK6 has been linked to decreased survival in lung adenocarcinoma, breast cancer, and melanoma. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3706 Product name: Recombinant human MAP2K6 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-334 aa of BC012009 Sequence: MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD Predict reactive species Full Name: mitogen-activated protein kinase kinase 6 Calculated Molecular Weight: 334 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC012009 Gene Symbol: MEK6 Gene ID (NCBI): 5608 RRID: AB_2141563 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52564 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924