Proteintech, 12749-1-AP, ADAMTS1 Polyclonal antibody

Size: 20ul / 150ul The ADAMTS1 (12749-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS1 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12749-1-AP targets ADAMTS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HEK-293 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3485 Product name: Recombinant human ADAMTS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 253-546 aa of BC036515 Sequence: FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCV Predict reactive species Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 1 Calculated Molecular Weight: 967 aa, 105 kDa GenBank Accession Number: BC036515 Gene Symbol: ADAMTS1 Gene ID (NCBI): 9510 RRID: AB_2877879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.