Proteintech, 12764-1-AP, FOXG1 Polyclonal antibody

Size: 20ul / 150ul The FOXG1 (12764-1-AP) by Proteintech is a Polyclonal antibody targeting FOXG1 in WB, ELISA applications with reactivity to human, mouse, rat samples 12764-1-AP targets FOXG1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse brain tissue, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Forkhead Box G1 (FOXG1) is a member of the Forkhead family of genes with non-redundant roles in brain development, where alteration of this gene's expression significantly affects the formation and function of the mammalian cerebral cortex. FOXG1 haploinsufficiency in humans is associated with prominent differences in brain size and impaired intellectual development noticeable in early childhood, while homozygous mutations are typically fatal. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3426 Product name: Recombinant human FOXG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-489 aa of BC035020 Sequence: IMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQSSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH Predict reactive species Full Name: forkhead box G1 Calculated Molecular Weight: 489 aa, 52 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC035020 Gene Symbol: FOXG1 Gene ID (NCBI): 2290 RRID: AB_2231894 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55316 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.