Proteintech, 12824-1-AP, VPS53 Polyclonal antibody

Size: 20ul / 150ul The VPS53 (12824-1-AP) by Proteintech is a Polyclonal antibody targeting VPS53 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12824-1-AP targets VPS53 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HEK-293 cells, human liver tissue, L02 cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information VPS53 is a component of the Golgi-associated retrograde protein (GARP) complex, also called VFT (VPS fifty-three) complex, composed of VPS51, VPS52, VPS53 and VPS54. GARP complex functions in traffic from endosomes to the trans-Golgi network (PMID: 15878329). GARP proteins interact with RAB proteins and SNARE proteins. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3518 Product name: Recombinant human VPS53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC029560 Sequence: MVLLDLPSISSQVVRKAPASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNYIKLLTDCNTETFQKILDMKGLKRSEQSSMLELLRQRLPAPPSGAESSGSLSLTAPTPEQESSRIRKLEKLIKKRL Predict reactive species Full Name: vacuolar protein sorting 53 homolog (S. cerevisiae) Calculated Molecular Weight: 832 aa, 94 kDa Observed Molecular Weight: 95-97 kDa GenBank Accession Number: BC029560 Gene Symbol: VPS53 Gene ID (NCBI): 55275 RRID: AB_2215514 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VIR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.