Proteintech, 12828-1-AP, EXTL2 Polyclonal antibody

Size: 20ul / 150ul The EXTL2 (12828-1-AP) by Proteintech is a Polyclonal antibody targeting EXTL2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12828-1-AP targets EXTL2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Exostosin-like 2 (EXTL2) is one of three EXT-like genes in the human genome that are homologous to EXT1 and EXT2, encodes a transferase that adds not only GlcNAc but also N-acetylgalactosamine to the glycosaminoglycan (GAG)-protein linkage region via an α1,4-linkage. Loss of the enzyme EXTL2, a regulatory mechanism serving to limit CSPG synthesis, resulted in more extensive versican deposition into a lysolecithin-induced demyelinated injury, a larger area of myelin disruption with an associated decrease in axonal density within the lesion, and greater accumulation of macrophages and microglia (PMID: 32703234, 23395820) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3548 Product name: Recombinant human EXTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-330 aa of BC036015 Sequence: LPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI Predict reactive species Full Name: exostoses (multiple)-like 2 Calculated Molecular Weight: 330 aa, 37 kDa Observed Molecular Weight: 37-43 kDa GenBank Accession Number: BC036015 Gene Symbol: EXTL2 Gene ID (NCBI): 2135 RRID: AB_2102130 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.