Proteintech, 12833-1-AP, Neuropeptide Y Polyclonal antibody

Size: 20ul / 150ul The Neuropeptide Y (12833-1-AP) by Proteintech is a Polyclonal antibody targeting Neuropeptide Y in IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 12833-1-AP targets Neuropeptide Y in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human brain tissue, mouse brain tissue, human pancreas cancer tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue, mouse eye tissue Positive IF-Fro detected in: rat brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Neuropeptide Y (NPY) is one of the most abundant peptides in the mammalian central nervous system (CNS). NPY has been linked to several physiological and pathological functions, such as feeding behaviour, memory processing, pain, anxiety, cell proliferation and many other processes in the central and peripheral nervous systems. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. In addition, NPY was suggested as a potential neuroprotective agent in Alzheimer's disease by counteracting the toxic effect of β-amyloid in an in vitro model. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3568 Product name: Recombinant human NPY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC029497 Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW Predict reactive species Full Name: neuropeptide Y Calculated Molecular Weight: 97 aa, 11 kDa GenBank Accession Number: BC029497 Gene Symbol: Neuropeptide Y Gene ID (NCBI): 4852 RRID: AB_10791890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01303 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.