Iright
BRAND / VENDOR: Proteintech

Proteintech, 12836-1-AP, GYG1 Polyclonal antibody

CATALOG NUMBER: 12836-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GYG1 (12836-1-AP) by Proteintech is a Polyclonal antibody targeting GYG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12836-1-AP targets GYG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, human testis tissue, U-251 cells Positive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissue, rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The GYG1 gene encodes glycogenin-1, a core protein in muscle glycogen particles. GYG1 is a glycosyltransferase that forms a short glucose polymer of approximately 10 glucose residues by autoglucosylation (PMID: 25272951 ). Cardiomyopathy and muscle weakness associated with muscle glycogen depletion can also be caused by impaired priming of glycogen synthesis due to inactivation of muscle glycogenin (glycogenin-1) (PMID: 20357282). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3583 Product name: Recombinant human GYG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC031096 Sequence: DQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ Predict reactive species Full Name: glycogenin 1 Calculated Molecular Weight: 350 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC031096 Gene Symbol: GYG1 Gene ID (NCBI): 2992 RRID: AB_2116101 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46976 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924