Proteintech, 12859-1-AP, CCL3L1 Polyclonal antibody

Size: 20ul / 150ul The CCL3L1 (12859-1-AP) by Proteintech is a Polyclonal antibody targeting CCL3L1 in WB, ELISA applications with reactivity to human samples 12859-1-AP targets CCL3L1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CCL3L1 is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3891 Product name: Recombinant human CCL3L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC027888 Sequence: MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA Predict reactive species Full Name: chemokine (C-C motif) ligand 3-like 1 Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC027888 Gene Symbol: CCL3L1 Gene ID (NCBI): 6349 RRID: AB_3085401 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16619 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.