Iright
BRAND / VENDOR: Proteintech

Proteintech, 12912-3-AP, TGM1 Polyclonal antibody

CATALOG NUMBER: 12912-3-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TGM1 (12912-3-AP) by Proteintech is a Polyclonal antibody targeting TGM1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 12912-3-AP targets TGM1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human saliva, mouse kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human cervical cancer tissue, human bowen disease, human brown disease, human cervix tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Transglutaminase 1 is an epidermal enzyme that is expressed during the terminal differentiation of keratinized squamous epithelium to form cornified cell envelopes in differentiated keratinocytes. Mutation of TGM1 has been linked to various epidermal diseases. This antibody recognizes the endogenous 90 kDa TGM1 proteins. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3905 Product name: Recombinant human TGM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 467-817 aa of BC034699 Sequence: SGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA Predict reactive species Full Name: transglutaminase 1 (K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase) Calculated Molecular Weight: 817 aa, 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC034699 Gene Symbol: TGM1 Gene ID (NCBI): 7051 RRID: AB_2271748 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924