Proteintech, 12913-1-AP, GK2 Polyclonal antibody

Size: 20ul / 150ul The GK2 (12913-1-AP) by Proteintech is a Polyclonal antibody targeting GK2 in WB, ELISA applications with reactivity to human, mouse, rat samples 12913-1-AP targets GK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information GK2 (glycerol kinase 2) is a key enzyme in the regulation of glycerol uptake and metabolism. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4010 Product name: Recombinant human GK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-324 aa of BC029820 Sequence: NSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEILQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIYGLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGLLTTVAYKLGREKPAYYALEGSVAI Predict reactive species Full Name: glycerol kinase 2 Calculated Molecular Weight: 553 aa, 61 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC029820 Gene Symbol: GK2 Gene ID (NCBI): 2712 RRID: AB_3669150 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14410 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.