Proteintech, 12941-1-AP, PSMF1 Polyclonal antibody

Size: 20ul / 150ul The PSMF1 (12941-1-AP) by Proteintech is a Polyclonal antibody targeting PSMF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12941-1-AP targets PSMF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human kidney tissue, human heart tissue, Jurkat cells, Neuro-2a cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PSMF1 is also named as PI31(proteasome (prosome, macropain) inhibitor subunit 1) and belongs to proteasome inhibitor PI31 family. PI31, which localizes at the nuclear envelope/endoplasmic reticulum membrane, acts as a selective modulator of the proteasome-mediated steps in MHC class I antigen processing(PMID:18495667). PI31 does not inhibit cell-surface transport of glycoproteins in general and it may serve to control immunoproteasome formation and may thereby maintain an intracellular balance between constitutive and immunoproteasomes(PMID:12374861). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4011 Product name: Recombinant human PSMF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 122-271 aa of BC029836 Sequence: RTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL Predict reactive species Full Name: proteasome (prosome, macropain) inhibitor subunit 1 (PI31) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC029836 Gene Symbol: PSMF1 Gene ID (NCBI): 9491 RRID: AB_2268855 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92530 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.