Iright
BRAND / VENDOR: Proteintech

Proteintech, 12945-1-AP, GAGE7 Polyclonal antibody

CATALOG NUMBER: 12945-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GAGE7 (12945-1-AP) by Proteintech is a Polyclonal antibody targeting GAGE7 in WB, IHC, ELISA applications with reactivity to human samples 12945-1-AP targets GAGE7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, BGC-823 cells, DU 145 cells, HGC-27 cells, MKN-45 cells, PC-3 cells Positive IHC detected in: human prostate cancer tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GAGE7 (G Antigen 7), also known as CT4.7 or GAGE-7, is a cancer-testis antigen belonging to the GAGE family. It is predominantly expressed in germ cells of the testis and various tumors, including melanoma, lung, and breast cancers, while remaining silent in normal adult tissues (PMID: 10397259). GAGE7 is an intrinsically disordered protein (IDP) of 117 amino acids with a theoretical molecular weight of ~13 kDa; however, it exhibits an apparent molecular weight of ~26 kDa in SDS-PAGE due to its abnormal electrophoretic mobility (PMID: 23029259). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4018 Product name: Recombinant human GAGE7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC031628 Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC Predict reactive species Full Name: G antigen 7 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC031628 Gene Symbol: GAGE7 Gene ID (NCBI): 2579 RRID: AB_2877895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76087 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924