Proteintech, 12976-1-AP, PASD1 Polyclonal antibody

Size: 20ul / 150ul The PASD1 (12976-1-AP) by Proteintech is a Polyclonal antibody targeting PASD1 in WB, ELISA applications with reactivity to human samples 12976-1-AP targets PASD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3587 Product name: Recombinant human PASD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 424-773 aa of BC040301 Sequence: LQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSLKNTGELQEPCVAFNQQQLVQQEQHLKEQQRQLREQLQQLREQRKVQKQKKMQEKKKLQEQKMQEKKKLQEQRRQKKKKLQERKKWQGQMLQKEPEEEQQKQQLQEQPLKHNVIVGNERVQICLQNPRDVSVPLCNHPVRFLQAQPIVPVQRAAEQQPSGFYQDENCGQQEDESQSFYPEAYQGPPVNQLPLIDTSNSEAISSSSIPQFPITSDSTISTLETPQDYIRLWQELSDSLGPVVQVNTWSCDEQGTLHGQPTYHQVQVSEVGVEGPPDPQAFQGPAAYQPDQMRSAEQTRLMPAEQRDSNKPC Predict reactive species Full Name: PAS domain containing 1 Calculated Molecular Weight: 773 aa, 87 kDa Observed Molecular Weight: 72-87 kDa GenBank Accession Number: BC040301 Gene Symbol: PASD1 Gene ID (NCBI): 139135 RRID: AB_2877900 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IV76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.