Iright
BRAND / VENDOR: Proteintech

Proteintech, 12981-1-AP, NFYA Polyclonal antibody

CATALOG NUMBER: 12981-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NFYA (12981-1-AP) by Proteintech is a Polyclonal antibody targeting NFYA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12981-1-AP targets NFYA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HT-1080 cells, Jurkat cells, K-562 cells Positive IHC detected in: human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NFYA, also named as Nuclear transcription factor Y subunit alpha, is a 347 amino acid protein, which contains 1 NFYA/HAP2-type DNA-binding domain and belongs to the NFYA/HAP2 subunit family. NFYA exists the two 41- to 45-kDa isoforms of NF-YA ( 11287613 ). NFYA is a component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. NF-YA positively regulates the transcription of the core clock component ARNTL/BMAL1 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3604 Product name: Recombinant human NFYA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC039244 Sequence: MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYNRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGG Predict reactive species Full Name: nuclear transcription factor Y, alpha Calculated Molecular Weight: 318aa,34 kDa; 347aa,39 kDa Observed Molecular Weight: 40 kDa, 46 kDa GenBank Accession Number: BC039244 Gene Symbol: NFYA Gene ID (NCBI): 4800 RRID: AB_10644128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924