Iright
BRAND / VENDOR: Proteintech

Proteintech, 12982-1-AP, TPTE Polyclonal antibody

CATALOG NUMBER: 12982-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TPTE (12982-1-AP) by Proteintech is a Polyclonal antibody targeting TPTE in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12982-1-AP targets TPTE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, human testis tissue, BxPC-3 cells, mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TPTE(Transmembrane phosphatase with tensin homology) is also named as CT44, BJ-HCC-5 and belongs to the non receptor class of the protein-tyrosine phosphatase family. The gene encodes a predicted polypeptide of 551 amino acids with at least 2 potential transmembrane domains and a tyrosine phosphatase motif. TPTE may be involved in the signal transduction pathways of the endocrine or spermatogenic function of the testis(PMID:10598804). It is putatively involved in linking the cell membrane to cytoskeleton. This protein is very similar in sequence to PTEN through the phosphatase and C2 domains, but lacks a PDZ binding motif and an extensively phosphorylated C-terminal tail(PMID:17240336). It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3606 Product name: Recombinant human TPTE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-533 aa of BC028719 Sequence: KRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVETPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD Predict reactive species Full Name: transmembrane phosphatase with tensin homology Calculated Molecular Weight: 62 kDa, 64 kDa Observed Molecular Weight: 62 kDa, 64 kDa GenBank Accession Number: BC028719 Gene Symbol: TPTE Gene ID (NCBI): 7179 RRID: AB_2206336 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56180 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924