Iright
BRAND / VENDOR: Proteintech

Proteintech, 12990-1-AP, PGRMC1 Polyclonal antibody

CATALOG NUMBER: 12990-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PGRMC1 (12990-1-AP) by Proteintech is a Polyclonal antibody targeting PGRMC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12990-1-AP targets PGRMC1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse liver tissue, HepG2 cells, MCF-7 cells, mouse kidney tissue, mouse ovary tissue Positive IP detected in: MCF-7 cells Positive IHC detected in: human cervical cancer tissue, human lung cancer tissue, human ovary tumor tissue, mouse kidney tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Progesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3643 Product name: Recombinant human PGRMC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-195 aa of BC034238 Sequence: YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND Predict reactive species Full Name: progesterone receptor membrane component 1 Calculated Molecular Weight: 195 aa, 22 kDa Observed Molecular Weight: 22-28 kDa GenBank Accession Number: BC034238 Gene Symbol: PGRMC1 Gene ID (NCBI): 10857 RRID: AB_2164342 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00264 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924