Iright
BRAND / VENDOR: Proteintech

Proteintech, 13008-1-AP, PTPRS Polyclonal antibody

CATALOG NUMBER: 13008-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PTPRS (13008-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRS in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13008-1-AP targets PTPRS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Type II a receptor protein tyrosine phosphatases (rPTPσ) are cell surface receptors important for nervous system development, function, and repair.The expression of rPTPσ has previously been reported in b-cells and other target organs for INS although the probes chosen did not permit to distinguish between the splice variants.Proteolytic processing near the transmembrane domain generates an extracellular N-terminal E-domain of 130 kDa and a C-terminal P-domain of approximately 85 kDa of rPTPσ,and the short splice variants rPTPσ 3 and 4 contain an E-domain of 95 kDa (PMID: 16552719). rPTPσ expression was observed in tissue lysates of the adult mouse sensory-motor cortex and thoracic spinal cord (T8-T10) as a 75-80kDa immunoreactive band (PMID: 19780196). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3691 Product name: Recombinant human rPTPσ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-128 aa of BC029496 Sequence: GGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRGP Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, S Calculated Molecular Weight: 128aa,14 kDa; 1948aa,217 kDa Observed Molecular Weight: 75-100 kDa GenBank Accession Number: BC029496 Gene Symbol: PTPRS Gene ID (NCBI): 5802 RRID: AB_10858319 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13332 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924