Iright
BRAND / VENDOR: Proteintech

Proteintech, 13010-1-AP, RPIA Polyclonal antibody

CATALOG NUMBER: 13010-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RPIA (13010-1-AP) by Proteintech is a Polyclonal antibody targeting RPIA in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13010-1-AP targets RPIA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, HEK-293 cells, MCF-7 cells, PC-3 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information RPIA(Ribose-5-phosphate isomerase) is also named as RPI and belongs to the ribose 5-phosphate isomerase family. It is involved in pentose-phosphate shunt, non-oxidative branch. It is an enzyme in the pentose-phosphate pathway, appears to be determined by a single structural locus and is probably a dimer(PMID:7396409). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3699 Product name: Recombinant human RPIA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-311 aa of BC015529 Sequence: MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTSTSCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC Predict reactive species Full Name: ribose 5-phosphate isomerase A Calculated Molecular Weight: 311 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC015529 Gene Symbol: RPIA Gene ID (NCBI): 22934 RRID: AB_10638301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49247 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924