Iright
BRAND / VENDOR: Proteintech

Proteintech, 13013-1-AP, NKX2-2 Polyclonal antibody

CATALOG NUMBER: 13013-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NKX2-2 (13013-1-AP) by Proteintech is a Polyclonal antibody targeting NKX2-2 in WB, IHC, IF, ELISA applications with reactivity to human, mouse, rat samples 13013-1-AP targets NKX2-2 in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Min6 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: E16.5 mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF): IF : 1:20 - 1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4069 Product name: Recombinant human NKX2-2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC075092 Sequence: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKR Predict reactive species Full Name: NK2 homeobox 2 Calculated Molecular Weight: 273 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC075092 Gene Symbol: NKX2-2 Gene ID (NCBI): 4821 RRID: AB_2877903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95096 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924