Iright
BRAND / VENDOR: Proteintech

Proteintech, 13049-1-AP, ARL8B Polyclonal antibody

CATALOG NUMBER: 13049-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ARL8B (13049-1-AP) by Proteintech is a Polyclonal antibody targeting ARL8B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13049-1-AP targets ARL8B in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, human brain tissue, mouse brain tissue, NIH/3T3 cells Positive IHC detected in: mouse brain tissue, human stomach cancer tissue, mouse kidney tissue, rat pancreas tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ARL8B ( ADP-ribosylation factor-like 8B) , also known as ARL10C or GIE1, is a small GTPase of the Arl-family, that is associated with the lysosome. ARL8A interacts with Tubulin, and plays a role in lysosome motility, as well as in chromosomal segregation. ARL8B plays a role in the spatial distribution and positioning of lysosomes. ARL8B is regarded as a regulator of endosome to lysosome trafficking pathways of special significance for host defense. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3711 Product name: Recombinant human ARL8B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC013131 Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS Predict reactive species Full Name: ADP-ribosylation factor-like 8B Calculated Molecular Weight: 186 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC013131 Gene Symbol: ARL8B Gene ID (NCBI): 55207 RRID: AB_2059000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924