Proteintech, 13053-1-AP, PFDN2 Polyclonal antibody

Size: 20ul / 150ul The PFDN2 (13053-1-AP) by Proteintech is a Polyclonal antibody targeting PFDN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13053-1-AP targets PFDN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, Neuro-2a cells Positive IHC detected in: human lung cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3720 Product name: Recombinant human PFDN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC012464 Sequence: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS Predict reactive species Full Name: prefoldin subunit 2 Calculated Molecular Weight: 154 aa, 17 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC012464 Gene Symbol: PFDN2 Gene ID (NCBI): 5202 RRID: AB_2877905 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.