Product Description
Size: 20ul / 150ul
The S100A7/Psoriasin (13061-1-AP) by Proteintech is a Polyclonal antibody targeting S100A7/Psoriasin in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
13061-1-AP targets S100A7/Psoriasin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: MCF-7 cells
Positive IHC detected in: human oesophagus cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
S100A7 (psoriasin), a member of the S100 protein family, is a well-known antimicrobial peptide and a signaling molecule which regulates cellular function and is expressed in many squamous cell carcinomas (SCCs), such as SCC of the skin. It is an EF-hand type calcium binding protein localized in epithelial cells, regulates cell proliferation and differentiation. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag3738 Product name: Recombinant human S100A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC034687 Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ Predict reactive species
Full Name: S100 calcium binding protein A7
Calculated Molecular Weight: 101 aa, 11 kDa
Observed Molecular Weight: 11 kDa
GenBank Accession Number: BC034687
Gene Symbol: S100A7/Psoriasin
Gene ID (NCBI): 6278
RRID: AB_2877908
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P31151
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924