Proteintech, 13068-1-AP, MCFD2 Polyclonal antibody

Size: 20ul / 150ul The MCFD2 (13068-1-AP) by Proteintech is a Polyclonal antibody targeting MCFD2 in IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13068-1-AP targets MCFD2 in IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3768 Product name: Recombinant human MCFD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC040357 Sequence: MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ Predict reactive species Full Name: multiple coagulation factor deficiency 2 Calculated Molecular Weight: 146 aa, 16 kDa GenBank Accession Number: BC040357 Gene Symbol: MCFD2 Gene ID (NCBI): 90411 RRID: AB_2877912 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.