Iright
BRAND / VENDOR: Proteintech

Proteintech, 13085-1-AP, CTNS Polyclonal antibody

CATALOG NUMBER: 13085-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CTNS (13085-1-AP) by Proteintech is a Polyclonal antibody targeting CTNS in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13085-1-AP targets CTNS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The CTNS or cystinosin is a lysosomal membrane protein which comprises with seven transmembrane domains, a 128 amino acid N-terminal region bearing seven N-glycosylation sites and a cytosolic C-terminal GYDQL sorting motif. It functions as a H+-driven cystine transporter responsible for cystine export from lysosomes. The mutation of CTNS gene cause an inherited disorder, cystinosis, characterized by defective lysosomal efflux of cystine. This antibody was raised against the N-terminal region of human cystinosin. Two isoforms of CTNS exist due to alternative splicing events and both of them can be detected through this antibody. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3904 Product name: Recombinant human CTNS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-170 aa of BC032850 Sequence: VSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRRKSVIGLSFDFVALNLTGF Predict reactive species Full Name: cystinosis, nephropathic Calculated Molecular Weight: 400aa,45 kDa; 367aa,42 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC032850 Gene Symbol: CTNS Gene ID (NCBI): 1497 RRID: AB_2230084 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60931 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924