Proteintech, 13089-1-AP, TRX2/TXN2 Polyclonal antibody

Size: 20ul / 150ul The TRX2/TXN2 (13089-1-AP) by Proteintech is a Polyclonal antibody targeting TRX2/TXN2 in WB, IHC, ELISA applications with reactivity to human samples 13089-1-AP targets TRX2/TXN2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, human liver tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TXN2 (Thioredoxin-2) is also named as TRX2, MTRX, Mt-TRX and regulates the mitochondrial redox state and plays an important role in cell proliferation. It has been shown that cells conditionally deficient in Trx2 undergo apoptosis in the absence of exogenous stress, accompanied by an accumulation of intracellular ROS, the activation of caspase 9 and caspase 3, and the release of cytochrome c into the cytosol. In the retina, the expression profile and the role of Trx2 have not yet been defined (PMID: 18441302). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3640 Product name: Recombinant human TRX2,TXN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC013726 Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Predict reactive species Full Name: thioredoxin 2 Calculated Molecular Weight: 166 aa, 18 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC013726 Gene Symbol: Thioredoxin 2 Gene ID (NCBI): 25828 RRID: AB_2304119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.