Proteintech, 13102-2-AP, SERPINB8 Polyclonal antibody

Size: 20ul / 150ul The SERPINB8 (13102-2-AP) by Proteintech is a Polyclonal antibody targeting SERPINB8 in WB, IHC, ELISA applications with reactivity to human, mouse samples 13102-2-AP targets SERPINB8 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, mouse lung tissue Positive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3740 Product name: Recombinant human SERPINB8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC034528 Sequence: MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE Predict reactive species Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 8 Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 45-48 kDa GenBank Accession Number: BC034528 Gene Symbol: SERPINB8 Gene ID (NCBI): 5271 RRID: AB_2186472 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.