Proteintech, 13107-1-AP, ELF5 Polyclonal antibody

Size: 20ul / 150ul The ELF5 (13107-1-AP) by Proteintech is a Polyclonal antibody targeting ELF5 in WB, ELISA applications with reactivity to human samples 13107-1-AP targets ELF5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: T-47D cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ELF5 is an epithelium-specific ETS family transcription factor. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3762 Product name: Recombinant human ELF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC029743 Sequence: MLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKL Predict reactive species Full Name: E74-like factor 5 (ets domain transcription factor) Calculated Molecular Weight: 255 aa, 30 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC029743 Gene Symbol: ELF5 Gene ID (NCBI): 2001 RRID: AB_3669152 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.