Proteintech, 13121-1-AP, PDE1B Polyclonal antibody

Size: 20ul / 150ul The PDE1B (13121-1-AP) by Proteintech is a Polyclonal antibody targeting PDE1B in WB, ELISA applications with reactivity to mouse, rat samples 13121-1-AP targets PDE1B in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information PDE1B, also known as PDES1B, belongs to the cyclic nucleotide phosphodiesterase family and PDE1 subfamily. PDE1B degrades cAMP and cGMP and regulates various important physiological processes such as proliferation and lipogenesis (PMID: 21960012). PDE1B is enriched in brain tissue. PDE1B gene consists of two isoforms, PDE1B1 (encoding 61 kDa protein with 536 amino acid residues) and PDE1B2 (encoding 59 kDa protein containing 516 amino acid residues). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3817 Product name: Recombinant human PDE1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-536 aa of BC032226 Sequence: LLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD Predict reactive species Full Name: phosphodiesterase 1B, calmodulin-dependent Calculated Molecular Weight: 536 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC032226 Gene Symbol: PDE1B Gene ID (NCBI): 5153 RRID: AB_3085407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01064 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.