Proteintech, 13128-1-AP, FDFT1 Polyclonal antibody

Size: 20ul / 150ul The FDFT1 (13128-1-AP) by Proteintech is a Polyclonal antibody targeting FDFT1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 13128-1-AP targets FDFT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, T-47D cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Farnesyl-diphosphate farnesyltransferase 1 (FDFT1), also known as SQS, is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3743 Product name: Recombinant human SQS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC029641 Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK Predict reactive species Full Name: farnesyl-diphosphate farnesyltransferase 1 Calculated Molecular Weight: 417 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC029641 Gene Symbol: FDFT1 Gene ID (NCBI): 2222 RRID: AB_2294094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P37268 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.