Proteintech, 13149-1-AP, FBXW11 Polyclonal antibody

Size: 20ul / 150ul The FBXW11 (13149-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW11 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 13149-1-AP targets FBXW11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, SGC-7901 cells, human stomach tissue, A549 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HCT 116 cells, A431 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FBXW11 (also known as HOS or β-TrCP2) is a member of F-box family proteins and plays critical role in regulating the ubiquitination of phosphorylated substrates. Abnormal expression of several FBXW11 is involved in the modulation of various biological events, such as cell cycle, differentiation, migration, inflammation, and apoptosis, through targeting multiple different substrates. For instance, FBXW11 could bind to the phosphorylated IκB and β-catenin, promoting their degradation via the ubiquitin-proteasome system. In addition, FBXW11 expression is markedly increased in mouse skin tumors and promotes tumor growth by activating the NF-κB signaling (PMID: 33640602). FBXW11 has 3 isoforms with the molecular mass of 58-62 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3761 Product name: Recombinant human FBXW11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 216-529 aa of BC026213 Sequence: NLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR Predict reactive species Full Name: F-box and WD repeat domain containing 11 Calculated Molecular Weight: 542 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC026213 Gene Symbol: FBXW11 Gene ID (NCBI): 23291 RRID: AB_2102595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKB1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.