Proteintech, 13151-1-AP, UGDH Polyclonal antibody

Size: 20ul / 150ul The UGDH (13151-1-AP) by Proteintech is a Polyclonal antibody targeting UGDH in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13151-1-AP targets UGDH in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information UDP-glucose 6-dehydrogenase (UGDH) is a key enzyme in the uronic acid pathway, and converts UDP-glucose (UDP-Glc) to UDP-glucuronic acid (UDP-GlcA). UGDH is critical to the production of extracellular matrix components which are essential to the migration and connectivity of neurons early in human brain development. UDP-GlcA is an essential sugar nucleotide precursor and a key component in the synthesis and stepwise degradation of glycosaminoglycans (GAGs). The protein subunit migrates on SDS-PAGE at ~55 kDa. (PMID: 32175296, PMID: 21576248, PMID: 31243371). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3767 Product name: Recombinant human UGDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC022781 Sequence: MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ Predict reactive species Full Name: UDP-glucose dehydrogenase Calculated Molecular Weight: 494 aa, 55 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC022781 Gene Symbol: UGDH Gene ID (NCBI): 7358 RRID: AB_2214083 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60701 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.