Iright
BRAND / VENDOR: Proteintech

Proteintech, 13181-1-AP, RBBP5 Polyclonal antibody

CATALOG NUMBER: 13181-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBBP5 (13181-1-AP) by Proteintech is a Polyclonal antibody targeting RBBP5 in WB, ELISA applications with reactivity to human samples 13181-1-AP targets RBBP5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information RBQ-3, also known as RBBP5 (retinoblastoma binding protein 5) or SWD1, is a 538 amino acid protein that localizes to the nucleus and contains six WD repeats. Expressed ubiquitously, RBQ-3 functions as a component of the Set1 complex and preferentially binds to underphosphorylated forms of the retinoblastoma (Rb) protein, possibly playing a role in the regulation of cell proliferation. RBQ-3 exists as two alternatively spliced isoforms and, upon DNA damage, is subject to phosphorylation by ATM or ATR. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3848 Product name: Recombinant human RBBP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-327 aa of BC037284 Sequence: MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDSKHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKGSCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWEKSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVE Predict reactive species Full Name: retinoblastoma binding protein 5 Calculated Molecular Weight: 538 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC037284 Gene Symbol: RBBP5 Gene ID (NCBI): 5929 RRID: AB_2177773 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924