Iright
BRAND / VENDOR: Proteintech

Proteintech, 13186-1-AP, MLF1IP Polyclonal antibody

CATALOG NUMBER: 13186-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MLF1IP (13186-1-AP) by Proteintech is a Polyclonal antibody targeting MLF1IP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13186-1-AP targets MLF1IP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, mouse testis tissue, rat liver tissue, U-87 MG cells Positive IHC detected in: mouse colon tissue, human colon tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information MLF1IP, also named as CENPU, ICEN24, KLIP1 and PBIP1, belongs to the CENP-U/AME1 family. MLF1IP plays an important role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. Moreover, MLF1IP has been shown to be involved in tumorigenesis in several types of cancer including glioblastoma, prostate cancer and luminal breast cancer (PMID: 27378428). MLF1IP has 3 isoforms with the molecular mass of 21, 38 and 47 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3858 Product name: Recombinant human MLF1IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-418 aa of BC031520 Sequence: MKTSDIKELNIVLPEFEKTHLEHQQRIESKVCKAAIATFYVNVKEQFIKMLKESQMLTNLKRKNAKMISDIEKKRQRMIEVQDELLRLEPQLKQLQTKYDELKERKSSLRNAAYFLSNLKQLYQDYSDVQAQEPNVKETYDSSSLPALLFKARTLLGAESHLRNINHQLEKLLDQG Predict reactive species Full Name: MLF1 interacting protein Calculated Molecular Weight: 418 aa, 48 kDa Observed Molecular Weight: 46-50 kDa, 60 kDa GenBank Accession Number: BC031520 Gene Symbol: MLF1IP Gene ID (NCBI): 79682 RRID: AB_10642941 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q71F23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924